PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g011520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 420aa    MW: 47999.8 Da    PI: 7.3809
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g011520.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.72.2e-18481291398
                     TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     ++rlv+p kf  +++ k   ++ +tl+++sg  ++v++  +   ++  +++GW++Fvk++ Lke+D +vFk++g sef   v +f+
  Csa12g011520.1  48 HHRLVIPQKFSIHCKRK--LPQIVTLKSPSGAIYNVRVEQDDDEKTLAFRSGWEKFVKDHSLKENDLLVFKFHGVSEF--EVLIFD 129
                     799*******9999766..7889***************88888888*************************9998999..888887 PP

2B357.32.9e-18315410299
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-.SS.SEE..EE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld.gr.sefelvv 94 
                       v+++s+v+ ++ l++p k + ++++  ++  +++ ++ + ++W +k+++ +++gr  +++GWk+Fv++n+L+e D++vF+ + ++ +  +l+v
  Csa12g011520.1 315 MVVMKRSHVS-KCFLTIPYKWCLKNNLLARQ--EVV-MQVDQKKWVMKFNFFGSRGRGGISTGWKKFVQDNNLRESDVCVFEPTnSEtKPLHLHV 405
                     5566555555.567***********888666..455.56799*******99999999889**********************6635567888888 PP

                     EEE-S CS
              B3  95 kvfrk 99 
                      +fr+
  Csa12g011520.1 406 YIFRA 410
                     88875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.29E-2134129IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.39436131IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.6E-2137129IPR015300DNA-binding pseudobarrel domain
CDDcd100178.35E-2038129No hitNo description
SMARTSM010192.0E-2039131IPR003340B3 DNA binding domain
PfamPF023625.6E-1648129IPR003340B3 DNA binding domain
PROSITE profilePS5086311.843313411IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-19314410IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.9E-20314410IPR015300DNA-binding pseudobarrel domain
CDDcd100174.49E-20314409No hitNo description
PfamPF023622.6E-16314410IPR003340B3 DNA binding domain
SMARTSM010191.1E-20314411IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005773Cellular Componentvacuole
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
YLSVVATGKR ERKKMEENCE DCMQWEEELY WTHFQTLHFS QLLLPGFHHR LVIPQKFSIH  60
CKRKLPQIVT LKSPSGAIYN VRVEQDDDEK TLAFRSGWEK FVKDHSLKEN DLLVFKFHGV  120
SEFEVLIFDG QTLCERPASY FVRKCGHADK TKGTDFTATS SRSPEIHFNP VGVETSPNQQ  180
RLISPPVVDN ELEDLIDIDV EIDTMLTPRL VVSQTGYDQE EHFNSDIDTA SAQLPVISPT  240
STGRVSKEKY PFSGLKKMRG EISNDSLDHK PGFENVTVIK TWSNLVLSLG YSMILEIRNK  300
ALSLAQRVVL PDGFMVVMKR SHVSKCFLTI PYKWCLKNNL LARQEVVMQV DQKKWVMKFN  360
FFGSRGRGGI STGWKKFVQD NNLRESDVCV FEPTNSETKP LHLHVYIFRA AEAESSNNG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00468DAPTransfer from AT4G33280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0356780.0AL035678.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F17M5 (ESSA project).
GenBankAL1615830.0AL161583.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 79.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010437778.10.0PREDICTED: B3 domain-containing protein REM16-like isoform X1
SwissprotQ8RYD11e-165REM16_ARATH; B3 domain-containing protein REM16
TrEMBLA0A087GJ881e-176A0A087GJ88_ARAAL; Uncharacterized protein
STRINGBra037010.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM104282335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.11e-166B3 family protein